Protein Purification
MilliporeSigma™ Calbiochem™ PCSK9 Inhibitor, EGF-A
A 42-mer synthetic peptide (GTNECLDNNGGCSHVCNDLKIGYECLCPDGFQLVAQRRCEDI-NH2) that contains a calcium binding site of EGF-A
MilliporeSigma™ Calbiochem™ PDK1/Akt/Flt Dual Pathway Inhibitor
The PDK1/Akt/Flt Dual Pathway Inhibitor, also referenced under CAS 331253-86-2, controls the biological activity of PDK1/Akt/Flt. This small molecule/inhibitor is primarily used for Phosphorylation & Dephosphorylation applications.
MilliporeSigma™ Calbiochem™ Phosphatase Inhibitor Cocktail Set IV
A cocktail of three phosphatase inhibitors for the inhibition of both serine/threonine and alkaline phosphatases.
MilliporeSigma™ Calbiochem™ TNF-TNFR Interaction Modulator, C87
Inhibits TNFα/β-stimulated biological activity by modulating, but not abolishing, TNF-TNFR interaction via direct TNF affinity interaction (KD = 110 nM).
MilliporeSigma™ Calbiochem™ Wnt Synergist, QS11
A cell-permeable purine compound that binds ARFGAPs (Kd = 364 and 620 nM for AMAP1 and ARFGAP1, respectively) and acts as a broad specificity ARFGAPs inhibitor (GTPase activating proteins of ADP-ribosylation factor).
MilliporeSigma™ Calbiochem™ DIDS, Disodium Salt
Binds covalently and irreversibly to the outer surface of human erythrocyte membranes.
MilliporeSigma™ Calbiochem™ (±)-Verapamil, Hydrochloride
A papaverine derivative that blocks Ca2+ channels (principally the L-type) in smooth and cardiac muscle cells.
MilliporeSigma™ Calbiochem™ MEK Inhibitor I
The MEK Inhibitor I, also referenced under CAS 297744-42-4, controls the biological activity of MEK. This small molecule/inhibitor is primarily used for Phosphorylation & Dephosphorylation applications.
MilliporeSigma™ Calbiochem™ ALLN
ALLN, CAS 110044-82-1, is a cell-permeable inhibitor of calpain I (Ki = 190 nM), calpain II (Ki = 220 nM), cathepsin B (Ki = 150 nM), and cathepsin L (Ki = 500 pM).
MilliporeSigma™ Calbiochem™ InSolution™ K-252a, Nocardiopsis sp.
A cell-permeable protein kinase inhibitor that inhibits CaM kinase II (Ki = 1
MilliporeSigma™ Calbiochem™ MMP-1 Substrate III, Fluorogenic
An excellent quenched fluorescence substrate for MMP-1.
MilliporeSigma™ Calbiochem™ SU6656
A potent, cell-permeable, reversible, and ATP-competitive Src family kinase inhibitor.
MilliporeSigma™ Calbiochem™ Hydroxyfasudil
A cell-permeable, hydroxylated metabolite of HA 1077 that displays anti-anginal properties.
MilliporeSigma™ Calbiochem™ Heat Shock Protein Inhibitor I
Heat Shock Protein Inhibitor I, CAS 218924-25-5 blocks the induction of HSP70, HSP72, and HSP105. Blocks the development of thermotolerance in a dose-dependent manner.
MilliporeSigma™ Calbiochem™ NF-κB SN50M, Cell-Permeable Inactive Control Peptide
An inactive control for SN50 peptide.